PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0088s0320.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 326aa    MW: 36987.3 Da    PI: 4.8281
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0088s0320.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.8e-092592912355
                             SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +yp++ee+++L+++ gL+++q+ +WF N+R ++
  SapurV1A.0088s0320.1.p 259 PYPTEEEKAKLSENSGLDQKQINNWFINQRKRH 291
                             8*****************************885 PP

2ELK249.3e-09212232222
                     ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                             LK  Ll KYsg+L++L++EF+
  SapurV1A.0088s0320.1.p 212 LKGVLLSKYSGHLSNLRKEFL 232
                             89999***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.9E-1863107IPR005540KNOX1
PfamPF037906.0E-1965103IPR005540KNOX1
SMARTSM012564.6E-22110167IPR005541KNOX2
PfamPF037913.2E-20113166IPR005541KNOX2
SMARTSM011881.8E-5211232IPR005539ELK domain
PROSITE profilePS512139.498211231IPR005539ELK domain
PfamPF037897.2E-8212232IPR005539ELK domain
PROSITE profilePS5007112.147231294IPR001356Homeobox domain
SMARTSM003894.1E-12233298IPR001356Homeobox domain
SuperFamilySSF466892.61E-17233301IPR009057Homeodomain-like
CDDcd000863.10E-13235295No hitNo description
Gene3DG3DSA:1.10.10.604.6E-26236297IPR009057Homeodomain-like
PfamPF059208.0E-16251290IPR008422Homeobox KN domain
PROSITE patternPS000270269292IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEGFYRFNPT ITCSPNDIDR LENLPVVKFT DATTSTDEFH SQVGNLLQAG HEYTQVTGSD  60
MHDVIKTQIA SHPRYPDLVS AYVECRKVGA PPETVSLLDD IGRWSYQIDT YYEIGADPEL  120
DEFMLLLFFK ESYCEVLHRY KEELSKPFDE ATTFLSGIES QLRSLCKGTL TKIFDDGSDE  180
PAGTSEEELS CGEVEASEIP DSLGTHPSDQ NLKGVLLSKY SGHLSNLRKE FLKQRKKGKL  240
PKDARTMLLD WWNHHSRWPY PTEEEKAKLS ENSGLDQKQI NNWFINQRKR HWKPSKDMRF  300
ALMESVRGDS AGPPCYGIDG DDIGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090453e-49AC209045.1 Populus trichocarpa clone POP061-B03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023778.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
SwissprotQ9FP291e-91KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLB9I6Z30.0B9I6Z3_POPTR; Uncharacterized protein
STRINGPOPTR_0013s01000.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-78KNOTTED1-like homeobox gene 6